Lineage for d1pwpa2 (1pwp A:551-776)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415443Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 415444Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 415821Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (1 protein)
  6. 415822Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
    duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain
  7. 415823Species Bacillus anthracis [TaxId:1392] [69777] (7 PDB entries)
  8. 415833Domain d1pwpa2: 1pwp A:551-776 [95233]
    Other proteins in same PDB: d1pwpa3, d1pwpb3

Details for d1pwpa2

PDB Entry: 1pwp (more details), 2.9 Å

PDB Description: Crystal Structure of the Anthrax Lethal Factor complexed with Small Molecule Inhibitor NSC 12155

SCOP Domain Sequences for d1pwpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pwpa2 d.92.1.14 (A:551-776) Anthrax toxin lethal factor, N- and C-terminal domains {Bacillus anthracis}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins

SCOP Domain Coordinates for d1pwpa2:

Click to download the PDB-style file with coordinates for d1pwpa2.
(The format of our PDB-style files is described here.)

Timeline for d1pwpa2: