| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein Surfactant protein, lectin domain [56461] (3 species) |
| Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (9 PDB entries) |
| Domain d1pwbb1: 1pwb B:235-355 [95214] Other proteins in same PDB: d1pwba2, d1pwbb2, d1pwbc2 complexed with ca, glc |
PDB Entry: 1pwb (more details), 1.4 Å
SCOPe Domain Sequences for d1pwbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pwbb1 d.169.1.1 (B:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f
Timeline for d1pwbb1:
View in 3DDomains from other chains: (mouse over for more information) d1pwba1, d1pwba2, d1pwbc1, d1pwbc2 |