Lineage for d1pw9b2 (1pw9 B:205-234)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1968225Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 1968226Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 1968298Protein Surfactant protein [57949] (2 species)
  7. 1968299Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries)
  8. 1968322Domain d1pw9b2: 1pw9 B:205-234 [95208]
    Other proteins in same PDB: d1pw9a1, d1pw9b1, d1pw9c1
    complexed with ca

Details for d1pw9b2

PDB Entry: 1pw9 (more details), 1.6 Å

PDB Description: high resolution crystal structure of an active recombinant fragment of human lung surfactant protein d
PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d1pw9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pw9b2 h.1.1.1 (B:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d1pw9b2:

Click to download the PDB-style file with coordinates for d1pw9b2.
(The format of our PDB-style files is described here.)

Timeline for d1pw9b2: