![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) ![]() |
![]() | Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
![]() | Protein Surfactant protein [57949] (2 species) |
![]() | Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries) |
![]() | Domain d1pw9b2: 1pw9 B:205-234 [95208] Other proteins in same PDB: d1pw9a1, d1pw9b1, d1pw9c1 complexed with ca |
PDB Entry: 1pw9 (more details), 1.6 Å
SCOPe Domain Sequences for d1pw9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pw9b2 h.1.1.1 (B:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]} aslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d1pw9b2:
![]() Domains from other chains: (mouse over for more information) d1pw9a1, d1pw9a2, d1pw9c1, d1pw9c2 |