SCOPe 2.08: Domain d1pw9b2: 1pw9 B:205-234

Lineage for d1pw9b2 (1pw9 B:205-234)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)

5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)

6. Protein Surfactant protein [57949] (3 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)

8. Domain d1pw9b2: 1pw9 B:205-234 [95208]
   Other proteins in same PDB: d1pw9a1, d1pw9b1, d1pw9c1
   complexed with ca

Details for d1pw9b2

PDB Entry: 1pw9, 1.6 Å

PDB Description: high resolution crystal structure of an active recombinant fragment of human lung surfactant protein d

PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d1pw9b2:

Sequence; same for both SEQRES and ATOM records:

>d1pw9b2 h.1.1.1 (B:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

Timeline for d1pw9b2:

• d1pw9b2 first appeared in SCOP 1.67
  
• d1pw9b2 appears in SCOPe 2.07