Lineage for d1pvrb2 (1pvr B:130-341)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939445Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 1939446Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 1939447Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)
  6. 1939448Protein Cre recombinase [56355] (1 species)
  7. 1939449Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries)
    Uniprot P06956 20-341
  8. 1939475Domain d1pvrb2: 1pvr B:130-341 [95188]
    Other proteins in same PDB: d1pvra1, d1pvrb1
    protein/DNA complex

Details for d1pvrb2

PDB Entry: 1pvr (more details), 2.65 Å

PDB Description: basis for a switch in substrate specificity: crystal structure of selected variant of cre site-specific recombinase, lnsgg bound to the loxp (wildtype) recognition site
PDB Compounds: (B:) Recombinase cre

SCOPe Domain Sequences for d1pvrb2:

Sequence, based on SEQRES records: (download)

>d1pvrb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllrlaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlsnsalggifgathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

Sequence, based on observed residues (ATOM records): (download)

>d1pvrb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllrlaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlsnsalggifgathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnltgamvrlled

SCOPe Domain Coordinates for d1pvrb2:

Click to download the PDB-style file with coordinates for d1pvrb2.
(The format of our PDB-style files is described here.)

Timeline for d1pvrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pvrb1