SCOP 1.67: Domain d1pvmb3: 1pvm B:143-178

Lineage for d1pvmb3 (1pvm B:143-178)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.13: Hypothetical protein Ta0289 C-terminal domain [103623] (1 family)
   contains CxxC-x(n)-CxxxxC zinc-binding site; sequence similarity to NAD-dependent DNA ligase zinc-finger subdomain

5. Family g.41.13.1: Hypothetical protein Ta0289 C-terminal domain [103624] (1 protein)

6. Protein Hypothetical protein Ta0289 C-terminal domain [103625] (1 species)

7. Species Archaeon Thermoplasma acidophilum [TaxId:2303] [103626] (1 PDB entry)

8. Domain d1pvmb3: 1pvm B:143-178 [95176]
   Other proteins in same PDB: d1pvma1, d1pvma2, d1pvmb1, d1pvmb2
   structural genomics
   complexed with hg

Details for d1pvmb3

PDB Entry: 1pvm, 1.5 Å

PDB Description: crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum

SCOP Domain Sequences for d1pvmb3:

Sequence; same for both SEQRES and ATOM records:

>d1pvmb3 g.41.13.1 (B:143-178) Hypothetical protein Ta0289 C-terminal domain {Archaeon Thermoplasma acidophilum}
qhlcpkcgvgvlepvynekgeikvfrcsnpacdyee

Timeline for d1pvmb3:

• d1pvmb3 is new in SCOP 1.67
  
• d1pvmb3 appears in SCOP 1.69
  
• d1pvmb3 appears in the current release, SCOPe 2.08