Lineage for d1pvmb1 (1pvm B:-5-64)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410626Fold d.37: CBS-domain [54630] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 410627Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 410628Family d.37.1.1: CBS-domain [54632] (4 proteins)
    pairs of CBS domains dimerize to form a stable globular domain
  6. 410633Protein Hypothetical protein Ta0289 [102899] (1 species)
    contains extra C-terminal zinc-finger domain
  7. 410634Species Archaeon Thermoplasma acidophilum [TaxId:2303] [102900] (1 PDB entry)
  8. 410637Domain d1pvmb1: 1pvm B:-5-64 [95174]
    Other proteins in same PDB: d1pvma3, d1pvmb3

Details for d1pvmb1

PDB Entry: 1pvm (more details), 1.5 Å

PDB Description: crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum

SCOP Domain Sequences for d1pvmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvmb1 d.37.1.1 (B:-5-64) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum}
vprgghmfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsers
iikrfiprnk

SCOP Domain Coordinates for d1pvmb1:

Click to download the PDB-style file with coordinates for d1pvmb1.
(The format of our PDB-style files is described here.)

Timeline for d1pvmb1: