Lineage for d1pvhc2 (1pvh C:197-301)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1297328Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1297329Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1297372Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)
  7. 1297373Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)
  8. 1297384Domain d1pvhc2: 1pvh C:197-301 [95169]
    Other proteins in same PDB: d1pvhb_, d1pvhd_
    complexed with iod

Details for d1pvhc2

PDB Entry: 1pvh (more details), 2.5 Å

PDB Description: Crystal structure of leukemia inhibitory factor in complex with gp130
PDB Compounds: (C:) interleukin-6 receptor beta chain

SCOPe Domain Sequences for d1pvhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvhc2 b.1.2.1 (C:197-301) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
kvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqippedta
strssftvqdlkpfteyvfrircmkedgkgywsdwseeasgitye

SCOPe Domain Coordinates for d1pvhc2:

Click to download the PDB-style file with coordinates for d1pvhc2.
(The format of our PDB-style files is described here.)

Timeline for d1pvhc2: