Lineage for d1pvhb_ (1pvh B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266371Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1266372Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1266373Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 1266427Protein Leukemia inhibitory factor (LIF) [47274] (2 species)
  7. 1266428Species Human (Homo sapiens) [TaxId:9606] [63529] (3 PDB entries)
  8. 1266429Domain d1pvhb_: 1pvh B: [95167]
    Other proteins in same PDB: d1pvha1, d1pvha2, d1pvhc1, d1pvhc2
    complexed with iod

Details for d1pvhb_

PDB Entry: 1pvh (more details), 2.5 Å

PDB Description: Crystal structure of leukemia inhibitory factor in complex with gp130
PDB Compounds: (B:) leukemia inhibitory factor

SCOPe Domain Sequences for d1pvhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvhb_ a.26.1.1 (B:) Leukemia inhibitory factor (LIF) {Human (Homo sapiens) [TaxId: 9606]}
cairhpchnnlmnqirsqlaqlngsanalfilyytaqgepfpnnldklcgpnvtdfppfh
angtekaklvelyrivvylgtslgnitrdqkilnpsalslhsklnatadilrgllsnvlc
rlcskyhvghvdvtygpdtsgkdvfqkkklgcqllgkykqiiavlaqaf

SCOPe Domain Coordinates for d1pvhb_:

Click to download the PDB-style file with coordinates for d1pvhb_.
(The format of our PDB-style files is described here.)

Timeline for d1pvhb_: