Lineage for d1pv9a2 (1pv9 A:125-345)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732939Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 732940Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 732941Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 732942Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 732943Species Archaeon Pyrococcus furiosus [TaxId:2261] [103237] (1 PDB entry)
  8. 732944Domain d1pv9a2: 1pv9 A:125-345 [95158]
    Other proteins in same PDB: d1pv9a1, d1pv9b1

Details for d1pv9a2

PDB Entry: 1pv9 (more details), 2 Å

PDB Description: Prolidase from Pyrococcus furiosus
PDB Compounds: (A:) Xaa-Pro Dipeptidase

SCOP Domain Sequences for d1pv9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pv9a2 d.127.1.1 (A:125-345) Aminopeptidase P, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}
ktkeeieiiekaceiadkavmaaieeitegkrerevaakveylmkmngaekpafdtiias
ghrsalphgvasdkriergdlvvidlgalynhynsditrtivvgspnekqreiyeivlea
qkraveaakpgmtakeldsiareiikeygygdyfihslghgvgleihewprisqydetvl
kegmvitiepgiyipklggvriedtvlitengakrltkter

SCOP Domain Coordinates for d1pv9a2:

Click to download the PDB-style file with coordinates for d1pv9a2.
(The format of our PDB-style files is described here.)

Timeline for d1pv9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pv9a1