Lineage for d1pv9a1 (1pv9 A:8-124)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701913Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) (S)
  5. 701914Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)
  6. 701915Protein Aminopeptidase P [53096] (2 species)
    synonym: Xaa-Pro dipeptidase, prolidase
  7. 701916Species Archaeon Pyrococcus furiosus [TaxId:2261] [102481] (1 PDB entry)
  8. 701917Domain d1pv9a1: 1pv9 A:8-124 [95157]
    Other proteins in same PDB: d1pv9a2, d1pv9b2

Details for d1pv9a1

PDB Entry: 1pv9 (more details), 2 Å

PDB Description: Prolidase from Pyrococcus furiosus
PDB Compounds: (A:) Xaa-Pro Dipeptidase

SCOP Domain Sequences for d1pv9a1:

Sequence, based on SEQRES records: (download)

>d1pv9a1 c.55.2.1 (A:8-124) Aminopeptidase P {Archaeon Pyrococcus furiosus [TaxId: 2261]}
lvkfmdensidrvfiakpvnvyyfsgtsplgggyiivdgdeatlyvpeleyemakeeskl
pvvkfkkfdeiyeilkntetlgiegtlsysmvenfkeksnvkefkkiddvikdlrii

Sequence, based on observed residues (ATOM records): (download)

>d1pv9a1 c.55.2.1 (A:8-124) Aminopeptidase P {Archaeon Pyrococcus furiosus [TaxId: 2261]}
lvkfmdensidrvfiakpvnvyyfsgtsplgggyiivdgdeatlyvpeleyemakeeskl
pvvkfkkfdeiyeilkntetlgiegtlsysmvenfkeksvkefkkiddvikdlrii

SCOP Domain Coordinates for d1pv9a1:

Click to download the PDB-style file with coordinates for d1pv9a1.
(The format of our PDB-style files is described here.)

Timeline for d1pv9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pv9a2