Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.251: Hypothetical protein YwqG [103031] (1 superfamily) duplication: contains two similar beta-x-beta(4) motifs swapped with the first strands |
Superfamily d.251.1: Hypothetical protein YwqG [103032] (1 family) automatically mapped to Pfam PF09234 |
Family d.251.1.1: Hypothetical protein YwqG [103033] (1 protein) |
Protein Hypothetical protein YwqG [103034] (1 species) |
Species Bacillus subtilis [TaxId:1423] [103035] (1 PDB entry) |
Domain d1pv5a_: 1pv5 A: [95150] structural genomics |
PDB Entry: 1pv5 (more details), 1.75 Å
SCOPe Domain Sequences for d1pv5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pv5a_ d.251.1.1 (A:) Hypothetical protein YwqG {Bacillus subtilis [TaxId: 1423]} mnhlpekmrpyrdlleksakeyvklnvrkgktgrydskiagdpyfpkhetyptdengqpm kllaqinfshipqldgypssgilqfyisvhddvyglnfddrceqknfrviyfenivendd elvsdfsfigtgecdfpilseaavepvkssewvlptdfqfeqytgmetmeffgqfgedee diynelaengfghkiggyasftqhdpreyaykehtimllqidsdddidsmwgdvgianff itpedlrkkdfsnvlynwdcs
Timeline for d1pv5a_: