Lineage for d1pv5a_ (1pv5 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614683Fold d.251: Hypothetical protein YwqG [103031] (1 superfamily)
    duplication: contains two similar beta-x-beta(4) motifs swapped with the first strands
  4. 2614684Superfamily d.251.1: Hypothetical protein YwqG [103032] (1 family) (S)
    automatically mapped to Pfam PF09234
  5. 2614685Family d.251.1.1: Hypothetical protein YwqG [103033] (1 protein)
  6. 2614686Protein Hypothetical protein YwqG [103034] (1 species)
  7. 2614687Species Bacillus subtilis [TaxId:1423] [103035] (1 PDB entry)
  8. 2614688Domain d1pv5a_: 1pv5 A: [95150]
    structural genomics

Details for d1pv5a_

PDB Entry: 1pv5 (more details), 1.75 Å

PDB Description: Structure of Protein of Unknown Function YwqG from Bacillus subtilis
PDB Compounds: (A:) Hypothetical protein ywqG

SCOPe Domain Sequences for d1pv5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pv5a_ d.251.1.1 (A:) Hypothetical protein YwqG {Bacillus subtilis [TaxId: 1423]}
mnhlpekmrpyrdlleksakeyvklnvrkgktgrydskiagdpyfpkhetyptdengqpm
kllaqinfshipqldgypssgilqfyisvhddvyglnfddrceqknfrviyfenivendd
elvsdfsfigtgecdfpilseaavepvkssewvlptdfqfeqytgmetmeffgqfgedee
diynelaengfghkiggyasftqhdpreyaykehtimllqidsdddidsmwgdvgianff
itpedlrkkdfsnvlynwdcs

SCOPe Domain Coordinates for d1pv5a_:

Click to download the PDB-style file with coordinates for d1pv5a_.
(The format of our PDB-style files is described here.)

Timeline for d1pv5a_: