Lineage for d1pusa_ (1pus A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211447Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2211603Protein Nucleoside triphosphate pyrophosphorylase (MutT) [55813] (2 species)
  7. 2211610Species Escherichia coli [TaxId:562] [55814] (6 PDB entries)
  8. 2211612Domain d1pusa_: 1pus A: [95139]
    complexed with 8og, mg

Details for d1pusa_

PDB Entry: 1pus (more details)

PDB Description: solution structure of the mutt pyrophosphohydrolase complexed with mg(2+) and 8-oxo-dgmp, a tightly-bound product
PDB Compounds: (A:) Mutator mutT protein

SCOPe Domain Sequences for d1pusa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pusa_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]}
mkklqiavgiirnenneifitrraadahmanklefpggkiemgetpeqavvrelqeevgi
tpqhfslfekleyefpdrhitlwfwlverwegepwgkegqpgewmslvglnaddfppane
pviaklkrl

SCOPe Domain Coordinates for d1pusa_:

Click to download the PDB-style file with coordinates for d1pusa_.
(The format of our PDB-style files is described here.)

Timeline for d1pusa_: