Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein Nucleoside triphosphate pyrophosphorylase (MutT) [55813] (2 species) |
Species Escherichia coli [TaxId:562] [55814] (6 PDB entries) |
Domain d1pusa_: 1pus A: [95139] complexed with 8og, mg |
PDB Entry: 1pus (more details)
SCOPe Domain Sequences for d1pusa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pusa_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} mkklqiavgiirnenneifitrraadahmanklefpggkiemgetpeqavvrelqeevgi tpqhfslfekleyefpdrhitlwfwlverwegepwgkegqpgewmslvglnaddfppane pviaklkrl
Timeline for d1pusa_: