SCOP 1.69: Domain d1pt3b_: 1pt3 B:

Lineage for d1pt3b_ (1pt3 B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (2 proteins)

6. Protein DNase domain of colicin E7 [54062] (1 species)

7. Species Escherichia coli [TaxId:562] [54063] (5 PDB entries)

8. Domain d1pt3b_: 1pt3 B: [95088]
   complexed with DNA

Details for d1pt3b_

PDB Entry: 1pt3, 2.5 Å

PDB Description: Crystal structures of nuclease-ColE7 complexed with octamer DNA

SCOP Domain Sequences for d1pt3b_:

Sequence; same for both SEQRES and ATOM records:

>d1pt3b_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli}
kpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpe
lskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtpkr
hidihrgk

Timeline for d1pt3b_:

• d1pt3b_ first appeared in SCOP 1.67
  
• d1pt3b_ appears in SCOP 1.71
  
• d1pt3b_ appears in the current release, SCOPe 2.08