![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
![]() | Superfamily d.4.1: His-Me finger endonucleases [54060] (5 families) ![]() common motif contains conserved histidine residue and metal-binding site |
![]() | Family d.4.1.1: HNH-motif [54061] (2 proteins) |
![]() | Protein DNase domain of colicin E7 [54062] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [54063] (5 PDB entries) |
![]() | Domain d1pt3b_: 1pt3 B: [95088] complexed with DNA |
PDB Entry: 1pt3 (more details), 2.5 Å
SCOP Domain Sequences for d1pt3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pt3b_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli} kpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpe lskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtpkr hidihrgk
Timeline for d1pt3b_: