Lineage for d1ps9a3 (1ps9 A:331-465,A:628-671)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 979303Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 979304Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 979305Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)
  6. 979306Protein 2,4-dienoyl-CoA reductase, middle domain [102187] (1 species)
  7. 979307Species Escherichia coli [TaxId:562] [102188] (1 PDB entry)
  8. 979308Domain d1ps9a3: 1ps9 A:331-465,A:628-671 [95078]
    Other proteins in same PDB: d1ps9a1, d1ps9a2
    complexed with cl, fad, fmn, mde, nap, sf4

Details for d1ps9a3

PDB Entry: 1ps9 (more details), 2.2 Å

PDB Description: the crystal structure and reaction mechanism of e. coli 2,4-dienoyl coa reductase
PDB Compounds: (A:) 2,4-dienoyl-CoA reductase

SCOPe Domain Sequences for d1ps9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]}
intcigcnqacldqifvgkvtsclvnprachetkmpilpavqkknlavvgagpaglafai
naaarghqvtlfdahseiggqfniakqipgkeefyetlryyrrmievtgvtlklnhtvta
dqlqafdetilasgiXpnralaqplidsgktvhliggcdvameldarraiaqgtrlalei

SCOPe Domain Coordinates for d1ps9a3:

Click to download the PDB-style file with coordinates for d1ps9a3.
(The format of our PDB-style files is described here.)

Timeline for d1ps9a3: