Lineage for d1pqya1 (1pqy A:4-418)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2493182Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2493183Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2493184Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 protein domains)
    forms interlocked homodimer of two ring-like subunits
  6. 2493241Protein Hypothetical protein YfdW [102709] (1 species)
  7. 2493242Species Escherichia coli [TaxId:562] [102710] (6 PDB entries)
  8. 2493251Domain d1pqya1: 1pqy A:4-418 [95041]
    Other proteins in same PDB: d1pqya2, d1pqya3
    structural genomics

Details for d1pqya1

PDB Entry: 1pqy (more details), 2.35 Å

PDB Description: Crystal structure of formyl-coA transferase yfdW from E. coli
PDB Compounds: (A:) Hypothetical protein yfdW

SCOPe Domain Sequences for d1pqya1:

Sequence, based on SEQRES records: (download)

>d1pqya1 c.123.1.1 (A:4-418) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]}
stplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyft
mlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprlif
gsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligll
aallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavpr
ggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystahar
qphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveveq
plrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai

Sequence, based on observed residues (ATOM records): (download)

>d1pqya1 c.123.1.1 (A:4-418) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]}
stplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyft
mlnsnkrsielntktaegkevmeklireadilvenfhpggftwehiqeinprlifgsikg
fdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligllaallh
rektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavprggnag
gggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystaharqphif
difaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveveqplrgk
yltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai

SCOPe Domain Coordinates for d1pqya1:

Click to download the PDB-style file with coordinates for d1pqya1.
(The format of our PDB-style files is described here.)

Timeline for d1pqya1: