PDB entry 1pqy

View 1pqy on RCSB PDB site
Description: Crystal structure of formyl-coA transferase yfdW from E. coli
Class: structural genomics, unknown function
Keywords: intertwined dimer, structural genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2003-06-19, released 2003-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yfdW
    Species: Escherichia coli [TaxId:562]
    Gene: YFDW
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69902 (3-417)
      • cloning artifact (2)
      • modified residue (26)
      • modified residue (63)
      • modified residue (84)
      • modified residue (175)
      • modified residue (199)
      • modified residue (201)
      • modified residue (342)
      • modified residue (375)
      • modified residue (411)
      • expression tag (418)
    Domains in SCOPe 2.08: d1pqya1, d1pqya2, d1pqya3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pqyA (A:)
    mslstplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidal
    yftmlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinpr
    lifgsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlli
    gllaallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgda
    vprggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaysta
    harqphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvve
    veqplrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhaieg
    gshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pqyA (A:)
    lstplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyf
    tmlnsnkrsielntktaegkevmeklireadilvenfhpggftwehiqeinprlifgsik
    gfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligllaall
    hrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavprggna
    ggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystaharqphi
    fdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveveqplrg
    kyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhaie