![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (2 proteins) automatically mapped to Pfam PF02966 |
![]() | Protein spliceosomal protein U5-15Kd [52896] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52897] (3 PDB entries) |
![]() | Domain d1pqna_: 1pqn A: [95025] |
PDB Entry: 1pqn (more details)
SCOPe Domain Sequences for d1pqna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pqna_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} symlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylv ditevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyr garkgrg
Timeline for d1pqna_: