Lineage for d1pqna_ (1pqn A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 396411Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (1 protein)
  6. 396412Protein spliceosomal protein U5-15Kd [52896] (1 species)
  7. 396413Species Human (Homo sapiens) [TaxId:9606] [52897] (2 PDB entries)
  8. 396415Domain d1pqna_: 1pqn A: [95025]
    mutant

Details for d1pqna_

PDB Entry: 1pqn (more details)

PDB Description: dominant negative human hdim1 (hdim1 1-128)

SCOP Domain Sequences for d1pqna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqna_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens)}
symlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylv
ditevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyr
garkgrg

SCOP Domain Coordinates for d1pqna_:

Click to download the PDB-style file with coordinates for d1pqna_.
(The format of our PDB-style files is described here.)

Timeline for d1pqna_: