SCOP 1.73: Domain d1pqia_: 1pqi A:

Lineage for d1pqia_ (1pqi A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.3: Phage lysozyme [53981] (3 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (431 PDB entries)
   many mutant structures

8. Domain d1pqia_: 1pqi A: [95019]
   complexed with bme, cl, k; mutant

Details for d1pqia_

PDB Entry: 1pqi, 1.57 Å

PDB Description: t4 lysozyme core repacking mutant i118l/core7/ta

PDB Compounds: (A:) lysozyme

SCOP Domain Sequences for d1pqia_:

Sequence; same for both SEQRES and ATOM records:

>d1pqia_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgvlrnaklkpmydsldavrraalinmvfqmgetgvagftnslry
lqqkrwdeaavnfaksrwynqtpnrakriitvfrtgtwdayknl

Timeline for d1pqia_:

• d1pqia_ first appeared in SCOP 1.67
  
• d1pqia_ appears in SCOP 1.71
  
• d1pqia_ appears in SCOP 1.75
  
• d1pqia_ appears in the current release, SCOPe 2.08