Lineage for d1pqia_ (1pqi A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 405476Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 405477Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 406028Family d.2.1.3: Phage T4 lysozymes [53981] (2 proteins)
  6. 406029Protein Phage T4 lysozyme [53982] (1 species)
  7. 406030Species Bacteriophage T4 [TaxId:10665] [53983] (395 PDB entries)
    many mutant structures
  8. 406100Domain d1pqia_: 1pqi A: [95019]
    complexed with bme, cl, k; mutant

Details for d1pqia_

PDB Entry: 1pqi (more details), 1.57 Å

PDB Description: t4 lysozyme core repacking mutant i118l/core7/ta

SCOP Domain Sequences for d1pqia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqia_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgvlrnaklkpmydsldavrraalinmvfqmgetgvagftnslry
lqqkrwdeaavnfaksrwynqtpnrakriitvfrtgtwdayknl

SCOP Domain Coordinates for d1pqia_:

Click to download the PDB-style file with coordinates for d1pqia_.
(The format of our PDB-style files is described here.)

Timeline for d1pqia_: