SCOPe 2.02: Domain d1pn9b1: 1pn9 B:84-209

Lineage for d1pn9b1 (1pn9 B:84-209)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class delta GST [81355] (5 species)
   formerly a part of class theta enzymes

7. Species African malaria mosquito (Anopheles gambiae), isozyme 1-6 [TaxId:7165] [101209] (1 PDB entry)

8. Domain d1pn9b1: 1pn9 B:84-209 [94951]
   Other proteins in same PDB: d1pn9a2, d1pn9b2
   complexed with gtx

Details for d1pn9b1

PDB Entry: 1pn9, 2 Å

PDB Description: Crystal structure of an insect delta-class glutathione S-transferase from a DDT-resistant strain of the malaria vector Anopheles gambiae

PDB Compounds: (B:) Glutathione S-transferase 1-6

SCOPe Domain Sequences for d1pn9b1:

Sequence; same for both SEQRES and ATOM records:

>d1pn9b1 a.45.1.1 (B:84-209) Class delta GST {African malaria mosquito (Anopheles gambiae), isozyme 1-6 [TaxId: 7165]}
pkdpqkravvnqrlyfdmgtlyqrfadyhypqifakqpanpenekkmkdavgflntfleg
qeyaagndltiadlslaatiatyevagfdfapypnvaawfarckanapgyalnqagadef
kakfls

Timeline for d1pn9b1:

• d1pn9b1 first appeared in SCOP 1.67
  
• d1pn9b1 appears in SCOPe 2.01
  
• d1pn9b1 appears in SCOPe 2.03
  
• d1pn9b1 appears in the current release, SCOPe 2.08