Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins) N-terminal all-beta domain defines family |
Protein Ketose reductase (sorbitol dehydrogenase) [51745] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [102130] (3 PDB entries) |
Domain d1pl8c2: 1pl8 C:146-316 [94883] Other proteins in same PDB: d1pl8a1, d1pl8b1, d1pl8c1, d1pl8d1 complexed with nad, zn |
PDB Entry: 1pl8 (more details), 1.9 Å
SCOPe Domain Sequences for d1pl8c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pl8c2 c.2.1.1 (C:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} vtfeegalieplsvgihacrrggvtlghkvlvcgagpigmvtllvakamgaaqvvvtdls atrlskakeigadlvlqiskespqeiarkvegqlgckpevtiectgaeasiqagiyatrs ggtlvlvglgsemttvpllhaairevdikgvfrycntwpvaismlasksvn
Timeline for d1pl8c2: