Lineage for d1pl6d2 (1pl6 D:146-316)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 685977Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 686246Protein Ketose reductase (sorbitol dehydrogenase) [51745] (2 species)
  7. 686247Species Human (Homo sapiens) [TaxId:9606] [102130] (3 PDB entries)
  8. 686259Domain d1pl6d2: 1pl6 D:146-316 [94869]
    Other proteins in same PDB: d1pl6a1, d1pl6b1, d1pl6c1, d1pl6d1
    complexed with 572, nad, zn

Details for d1pl6d2

PDB Entry: 1pl6 (more details), 2 Å

PDB Description: Human SDH/NADH/inhibitor complex
PDB Compounds: (D:) sorbitol dehydrogenase

SCOP Domain Sequences for d1pl6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl6d2 c.2.1.1 (D:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}
vtfeegalieplsvgihacrrggvtlghkvlvcgagpigmvtllvakamgaaqvvvtdls
atrlskakeigadlvlqiskespqeiarkvegqlgckpevtiectgaeasiqagiyatrs
ggtlvlvglgsemttvpllhaairevdikgvfrycntwpvaismlasksvn

SCOP Domain Coordinates for d1pl6d2:

Click to download the PDB-style file with coordinates for d1pl6d2.
(The format of our PDB-style files is described here.)

Timeline for d1pl6d2: