SCOP 1.75: Domain d1pl6d1: 1pl6 D:1-145,D:317-356

Lineage for d1pl6d1 (1pl6 D:1-145,D:317-356)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Ketose reductase (sorbitol dehydrogenase) [50145] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101710] (3 PDB entries)

8. Domain d1pl6d1: 1pl6 D:1-145,D:317-356 [94868]
   Other proteins in same PDB: d1pl6a2, d1pl6b2, d1pl6c2, d1pl6d2
   complexed with 572, nad, zn

Details for d1pl6d1

PDB Entry: 1pl6, 2 Å

PDB Description: Human SDH/NADH/inhibitor complex

PDB Compounds: (D:) sorbitol dehydrogenase

SCOP Domain Sequences for d1pl6d1:

Sequence; same for both SEQRES and ATOM records:

>d1pl6d1 b.35.1.2 (D:1-145,D:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}
aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
tppddgnlcrfykhnaafcyklpdnXvkplvthrfplekaleafetfkkglglkimlkcd
psdqnp

Timeline for d1pl6d1:

• d1pl6d1 first appeared in SCOP 1.67
  
• d1pl6d1 appears in SCOP 1.73
  
• d1pl6d1 appears in SCOPe 2.01
  
• d1pl6d1 appears in the current release, SCOPe 2.08