Lineage for d1pl4a2 (1pl4 A:84-198)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647686Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1647687Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1647688Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 1647814Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 1647878Species Human (Homo sapiens) [TaxId:9606] [54724] (26 PDB entries)
  8. 1647885Domain d1pl4a2: 1pl4 A:84-198 [94855]
    Other proteins in same PDB: d1pl4a1, d1pl4b1, d1pl4c1, d1pl4d1
    complexed with mn; mutant

Details for d1pl4a2

PDB Entry: 1pl4 (more details), 1.47 Å

PDB Description: crystal structure of human mnsod y166f mutant
PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d1pl4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl4a2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayflqyknvrpdylkaiwnvinwenvterymackk

SCOPe Domain Coordinates for d1pl4a2:

Click to download the PDB-style file with coordinates for d1pl4a2.
(The format of our PDB-style files is described here.)

Timeline for d1pl4a2: