SCOPe 2.08: Domain d1pkxc1: 1pkx C:4-200

Lineage for d1pkxc1 (1pkx C:4-200)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families)
   contains a common phosphate-binding site

5. Family c.24.1.3: Inosicase [63971] (1 protein)

6. Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102255] (3 PDB entries)

8. Domain d1pkxc1: 1pkx C:4-200 [94842]
   Other proteins in same PDB: d1pkxa2, d1pkxb2, d1pkxc2, d1pkxd2
   complexed with k, xmp

Details for d1pkxc1

PDB Entry: 1pkx, 1.9 Å

PDB Description: Crystal Structure of human ATIC in complex with XMP

PDB Compounds: (C:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d1pkxc1:

Sequence; same for both SEQRES and ATOM records:

>d1pkxc1 c.24.1.3 (C:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Human (Homo sapiens) [TaxId: 9606]}
gqlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdvseltgfpemlgg
rvktlhpavhagilarnipednadmarldfnlirvvacnlypfvktvaspgvtveeaveq
idiggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletrrqlalkafthta
qydeaisdyfrkqyskg

Timeline for d1pkxc1:

• d1pkxc1 first appeared in SCOP 1.67
  
• d1pkxc1 appears in SCOPe 2.07