SCOPe 2.08: Domain d1pkkb_: 1pkk B:

Lineage for d1pkkb_ (1pkk B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Bifunctional dCTP deaminase/dUTPase [89425] (1 species)
   elaborated fold with additional structures

7. Species Methanococcus jannaschii [TaxId:2190] [89426] (6 PDB entries)
   synonym: Methanocaldococcus jannaschii

8. Domain d1pkkb_: 1pkk B: [94837]
   complexed with dcp, edo
   has additional insertions and/or extensions that are not grouped together

Details for d1pkkb_

PDB Entry: 1pkk, 1.77 Å

PDB Description: Structural basis for recognition and catalysis by the bifunctional dCTP deaminase and dUTPase from Methanococcus jannaschii

PDB Compounds: (B:) bifunctional deaminase/diphosphatase

SCOPe Domain Sequences for d1pkkb_:

Sequence; same for both SEQRES and ATOM records:

>d1pkkb_ b.85.4.1 (B:) Bifunctional dCTP deaminase/dUTPase {Methanococcus jannaschii [TaxId: 2190]}
milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgy

Timeline for d1pkkb_:

• d1pkkb_ first appeared in SCOP 1.67
  
• d1pkkb_ appears in SCOPe 2.07