SCOP 1.71: Domain d1pkja_: 1pkj A:

Lineage for d1pkja_ (1pkj A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (3 proteins)

6. Protein Bifunctional dCTP deaminase/dUTPase [89425] (1 species)
   elaborated fold with additional structures

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [89426] (4 PDB entries)
   synonym: Methanocaldococcus jannaschii

8. Domain d1pkja_: 1pkj A: [94834]

Details for d1pkja_

PDB Entry: 1pkj, 2.1 Å

PDB Description: Structural basis for recognition and catalysis by the bifunctional dCTP deaminase and dUTPase from Methanococcus jannaschii

SCOP Domain Sequences for d1pkja_:

Sequence; same for both SEQRES and ATOM records:

>d1pkja_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii}
milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgyser

Timeline for d1pkja_:

• d1pkja_ first appeared in SCOP 1.67
  
• d1pkja_ appears in SCOP 1.69
  
• d1pkja_ appears in SCOP 1.73
  
• d1pkja_ appears in the current release, SCOPe 2.08