PDB entry 1pkj

View 1pkj on RCSB PDB site
Description: Structural basis for recognition and catalysis by the bifunctional dCTP deaminase and dUTPase from Methanococcus jannaschii
Deposited on 2003-06-05, released 2003-09-23
The last revision prior to the SCOP 1.71 freeze date was dated 2003-09-23, with a file datestamp of 2003-09-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1pkja_
  • Chain 'B':
    Domains in SCOP 1.71: d1pkjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pkjA (A:)
    milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
    iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
    grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgyser
    ktskyayqksvmpslihldnhkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkjA (A:)
    milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
    iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
    grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgyser
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pkjB (B:)
    milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
    iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
    grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgyser
    ktskyayqksvmpslihldnhkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkjB (B:)
    milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
    iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
    grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadv