Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.3: Synapsin C-terminal domain [56078] (3 proteins) automatically mapped to Pfam PF02750 |
Protein Synapsin [56079] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [103285] (2 PDB entries) |
Domain d1pk8d2: 1pk8 D:214-417 [94814] Other proteins in same PDB: d1pk8a1, d1pk8b1, d1pk8c1, d1pk8d1, d1pk8e1, d1pk8f1, d1pk8g1, d1pk8h1 complexed with atp, ca, edo |
PDB Entry: 1pk8 (more details), 2.1 Å
SCOPe Domain Sequences for d1pk8d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pk8d2 d.142.1.3 (D:214-417) Synapsin {Norway rat (Rattus norvegicus) [TaxId: 10116]} nslhsvynfcdkpwvfaqmvrlhkklgteefplidqtfypnhkemlssttypvvvkmgha hsgmgkvkvdnqhdfqdiasvvaltktyataepfidakydvrvqkigqnykaymrtsvsg nwktntgsamleqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmp ligdhqdedkqlivelvvnkmtqa
Timeline for d1pk8d2: