Lineage for d1pjtb2 (1pjt B:216-457)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1623746Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 1623747Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 1623748Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 1623928Protein Siroheme synthase CysG, domains 4 and 5 [102682] (1 species)
  7. 1623929Species Salmonella typhimurium [TaxId:90371] [102683] (3 PDB entries)
  8. 1623935Domain d1pjtb2: 1pjt B:216-457 [94782]
    Other proteins in same PDB: d1pjta1, d1pjta3, d1pjtb1, d1pjtb3
    complexed with po4, sah; mutant

Details for d1pjtb2

PDB Entry: 1pjt (more details), 2.8 Å

PDB Description: the structure of the ser128ala point-mutant variant of cysg, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis
PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d1pjtb2:

Sequence, based on SEQRES records: (download)

>d1pjtb2 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh
cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg
csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli
afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs
nh

Sequence, based on observed residues (ATOM records): (download)

>d1pjtb2 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkrahcv
pqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcs
aysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekliaf
gmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfsnh

SCOPe Domain Coordinates for d1pjtb2:

Click to download the PDB-style file with coordinates for d1pjtb2.
(The format of our PDB-style files is described here.)

Timeline for d1pjtb2: