![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily) 2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix |
![]() | Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (2 families) ![]() |
![]() | Family e.37.1.1: Siroheme synthase middle domains-like [75616] (2 proteins) |
![]() | Protein Siroheme synthase CysG, domains 2 and 3 [103403] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [103404] (5 PDB entries) |
![]() | Domain d1pjsb3: 1pjs B:114-215 [94777] Other proteins in same PDB: d1pjsa1, d1pjsa2, d1pjsb1, d1pjsb2 complexed with nad, pge, po4, sah |
PDB Entry: 1pjs (more details), 2.4 Å
SCOPe Domain Sequences for d1pjsb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pjsb3 e.37.1.1 (B:114-215) Siroheme synthase CysG, domains 2 and 3 {Salmonella typhimurium [TaxId: 90371]} psiidrsplmvavssggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmg errrfwekffvndrlaqslanadekavnatterlfsepldhr
Timeline for d1pjsb3: