PDB entry 1pjs

View 1pjs on RCSB PDB site
Description: The co-crystal structure of CysG, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis, in complex with it NAD cofactor
Class: transferase/oxidoreductase/lyase
Keywords: rossmann fold, nucleotide binding motif, SAH, SAM, NAD, phosphoserine, TRANSFERASE-OXIDOREDUCTASE-LYASE COMPLEX
Deposited on 2003-06-03, released 2003-12-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.239
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Siroheme synthase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: CYSG OR STM3477
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25924 (0-456)
      • modified residue (127)
    Domains in SCOPe 2.06: d1pjsa1, d1pjsa2, d1pjsa3
  • Chain 'B':
    Compound: Siroheme synthase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: CYSG OR STM3477
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25924 (0-456)
      • modified residue (127)
    Domains in SCOPe 2.06: d1pjsb1, d1pjsb2, d1pjsb3
  • Heterogens: PO4, SAH, NAD, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pjsA (A:)
    mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl
    vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfimpsiidrs
    plmvavssggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmgerrrfwe
    kffvndrlaqslanadekavnatterlfsepldhrgevvlvgagpgdaglltlkglqqiq
    qadivvydrlvsddimnlvrrdadrvfvgkragyhcvpqeeinqillreaqkgkrvvrlk
    ggdpfifgrggeeletlchagipfsvvpgitaasgcsaysgiplthrdyaqsvrlvtghl
    ktggeldwenlaaekqtlvfymglnqaatiqekliafgmqadmpvalvengtsvkqrvvh
    gvltqlgelaqqvespaliivgrvvalrdklnwfsnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pjsA (A:)
    mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl
    vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfimpsiidrs
    plmvavssggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmgerrrfwe
    kffvndrlaqslanadekavnatterlfsepldhrgevvlvgagpgdaglltlkglqqiq
    qadivvydrlvsddimnlvrrdadrvfvvpqeeinqillreaqkgkrvvrlkggdpfifg
    rggeeletlchagipfsvvpgitaasgcsaysgiplthrdyaqsvrlvtgeldwenlaae
    kqtlvfymglnqaatiqekliafgmqadmpvalvengtsvkqrvvhgvltqlgelaqqve
    spaliivgrvvalrdklnwfsnh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pjsB (B:)
    mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl
    vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfimpsiidrs
    plmvavssggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmgerrrfwe
    kffvndrlaqslanadekavnatterlfsepldhrgevvlvgagpgdaglltlkglqqiq
    qadivvydrlvsddimnlvrrdadrvfvgkragyhcvpqeeinqillreaqkgkrvvrlk
    ggdpfifgrggeeletlchagipfsvvpgitaasgcsaysgiplthrdyaqsvrlvtghl
    ktggeldwenlaaekqtlvfymglnqaatiqekliafgmqadmpvalvengtsvkqrvvh
    gvltqlgelaqqvespaliivgrvvalrdklnwfsnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pjsB (B:)
    mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl
    vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfimpsiidrs
    plmvavssggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmgerrrfwe
    kffvndrlaqslanadekavnatterlfsepldhrgevvlvgagpgdaglltlkglqqiq
    qadivvydrlvsddimnlvrrdadrvfvgkragyhcvpqeeinqillreaqkgkrvvrlk
    ggdpfifgrggeeletlchagipfsvvpgitaasgcsaysgiplthrdyaqsvrlvtghg
    geldwenlaaekqtlvfymglnqaatiqekliafgmqadmpvalvengtsvkqrvvhgvl
    tqlgelaqqvespaliivgrvvalrdklnwfsnh