Lineage for d1pjhc_ (1pjh C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099550Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 2099623Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (5 species)
  7. 2099624Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63954] (4 PDB entries)
  8. 2099627Domain d1pjhc_: 1pjh C: [94763]
    complexed with gol, so4

Details for d1pjhc_

PDB Entry: 1pjh (more details), 2.1 Å

PDB Description: structural studies on delta3-delta2-enoyl-coa isomerase: the variable mode of assembly of the trimeric disks of the crotonase superfamily
PDB Compounds: (C:) enoyl-CoA isomerase; Eci1p

SCOPe Domain Sequences for d1pjhc_:

Sequence, based on SEQRES records: (download)

>d1pjhc_ c.14.1.3 (C:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
irqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgr
ffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpai
glsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpf
kydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidaf
nkansvevneslkywvdgeplkrfrq

Sequence, based on observed residues (ATOM records): (download)

>d1pjhc_ c.14.1.3 (C:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
irqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgr
ffssgadfkgiaypsetskwvsnfvarnvyvtdafikhskvlicclngpaiglsaalval
cdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimceng
fisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansvevn
eslkywvdgeplkrfrq

SCOPe Domain Coordinates for d1pjhc_:

Click to download the PDB-style file with coordinates for d1pjhc_.
(The format of our PDB-style files is described here.)

Timeline for d1pjhc_: