Class b: All beta proteins [48724] (165 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (1 family) |
Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins) |
Protein N,N-dimethylglycine oxidase, C-terminal domain [101792] (1 species) |
Species Arthrobacter globiformis [TaxId:1665] [101793] (3 PDB entries) |
Domain d1pj7a1: 1pj7 A:743-830 [94750] Other proteins in same PDB: d1pj7a2, d1pj7a3, d1pj7a4 complexed with fad, fon, na |
PDB Entry: 1pj7 (more details), 2.1 Å
SCOP Domain Sequences for d1pj7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pj7a1 b.44.2.1 (A:743-830) N,N-dimethylglycine oxidase, C-terminal domain {Arthrobacter globiformis [TaxId: 1665]} arrlrcltiddgrsivlgkepvfykeqavgyvtsaaygytvakpiaysylpgtvsvgdsv dieyfgrritatvtedplydpkmtrlrg
Timeline for d1pj7a1: