SCOPe 2.02: Domain d1pj2a2: 1pj2 A:21-279

Lineage for d1pj2a2 (1pj2 A:21-279)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
   Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)

8. Domain d1pj2a2: 1pj2 A:21-279 [94719]
   Other proteins in same PDB: d1pj2a1, d1pj2b1, d1pj2c1, d1pj2d1
   complexed with fum, mlt, mn, nai

Details for d1pj2a2

PDB Entry: 1pj2, 2.3 Å

PDB Description: crystal structure of human mitochondrial nad(p)+-dependent malic enzyme in a pentary complex with natural substrate malate, cofactor nadh, mn++, and allosteric activator fumarate

PDB Compounds: (A:) NAD-dependent malic enzyme, mitochondrial

SCOPe Domain Sequences for d1pj2a2:

Sequence; same for both SEQRES and ATOM records:

>d1pj2a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
nafrflrkyrekyctfndd

Timeline for d1pj2a2:

• d1pj2a2 first appeared in SCOP 1.67
  
• d1pj2a2 appears in SCOPe 2.01
  
• d1pj2a2 appears in SCOPe 2.03
  
• d1pj2a2 appears in the current release, SCOPe 2.08