Lineage for d1pi4b_ (1pi4 B:)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 617469Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 617470Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 617471Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (13 proteins)
  6. 617472Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 617490Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (32 PDB entries)
  8. 617492Domain d1pi4b_: 1pi4 B: [94701]
    complexed with k, po4, sm3; mutant

Details for d1pi4b_

PDB Entry: 1pi4 (more details), 1.39 Å

PDB Description: structure of n289a mutant of ampc in complex with sm3, a phenylglyclboronic acid bearing the cephalothin r1 side chain

SCOP Domain Sequences for d1pi4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pi4b_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdakialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOP Domain Coordinates for d1pi4b_:

Click to download the PDB-style file with coordinates for d1pi4b_.
(The format of our PDB-style files is described here.)

Timeline for d1pi4b_: