Lineage for d1pdpj_ (1pdp J:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1250926Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily)
  4. 1250927Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family) (S)
  5. 1250928Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein)
  6. 1250929Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species)
  7. 1250930Species Bacteriophage T4 [TaxId:10665] [103678] (7 PDB entries)
  8. 1250994Domain d1pdpj_: 1pdp J: [94581]
    fitting of baseplate structural protein gp9

Details for d1pdpj_

PDB Entry: 1pdp (more details), 12 Å

PDB Description: fitting of gp9 structure into the bacteriophage t4 baseplate cryoem reconstruction
PDB Compounds: (J:) Baseplate structural protein Gp9

SCOPe Domain Sequences for d1pdpj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdpj_ i.19.1.1 (J:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4 [TaxId: 10665]}
mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq

SCOPe Domain Coordinates for d1pdpj_:

Click to download the PDB-style file with coordinates for d1pdpj_.
(The format of our PDB-style files is described here.)

Timeline for d1pdpj_: