Lineage for d1pdpe_ (1pdp E:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily)
  4. Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family) (S)
  5. Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein)
  6. Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species)
  7. Species Bacteriophage T4 [TaxId:10665] [103678] (7 PDB entries)
  8. 1712982Domain d1pdpe_: 1pdp E: [94576]
    fitting of baseplate structural protein gp9

Details for d1pdpe_

PDB Entry: 1pdp (more details), 12 Å

PDB Description: fitting of gp9 structure into the bacteriophage t4 baseplate cryoem reconstruction
PDB Compounds: (E:) Baseplate structural protein Gp9

SCOPe Domain Sequences for d1pdpe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdpe_ i.19.1.1 (E:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4 [TaxId: 10665]}
mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq

SCOPe Domain Coordinates for d1pdpe_:

Click to download the PDB-style file with coordinates for d1pdpe_.
(The format of our PDB-style files is described here.)

Timeline for d1pdpe_: