Class i: Low resolution protein structures [58117] (22 folds) |
Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily) |
Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family) |
Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein) |
Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [103678] (6 PDB entries) |
Domain d1pdml_: 1pdm L: [94571] fitting of baseplate structural protein gp8 |
PDB Entry: 1pdm (more details)
SCOP Domain Sequences for d1pdml_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdml_ i.19.1.1 (L:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4} iyraivtskfrtekmlnfynsigsgpdkntifitfgrsepwssnenevgfappyptdsvl gvtdmwthmmgtvkvlpsmldaviprrdwgdtrypdpytfrindivvcnsapynatesga gwlvyrcldvpdtgmcsiasltdkdeclklggkwtpsarsmtppegrgdaegtiepgdgy vweylfeippdvsinrctneyivvpwpeelkedptrwgyednltwqqddfgliyrvkant irfkayldsvyfpeaalpgnkgfrqisiitnpleakahpndpnvkaekdyydpedlmrhs gemiymenrppiimamdqteeinilftf
Timeline for d1pdml_: