Lineage for d1pdml_ (1pdm L:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 433883Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily)
  4. 433884Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family) (S)
  5. 433885Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein)
  6. 433886Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species)
  7. 433887Species Bacteriophage T4 [TaxId:10665] [103678] (6 PDB entries)
  8. 433941Domain d1pdml_: 1pdm L: [94571]
    fitting of baseplate structural protein gp8

Details for d1pdml_

PDB Entry: 1pdm (more details)

PDB Description: fitting of gp8 structure into the cryoem reconstruction of the bacteriophage t4 baseplate

SCOP Domain Sequences for d1pdml_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdml_ i.19.1.1 (L:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4}
iyraivtskfrtekmlnfynsigsgpdkntifitfgrsepwssnenevgfappyptdsvl
gvtdmwthmmgtvkvlpsmldaviprrdwgdtrypdpytfrindivvcnsapynatesga
gwlvyrcldvpdtgmcsiasltdkdeclklggkwtpsarsmtppegrgdaegtiepgdgy
vweylfeippdvsinrctneyivvpwpeelkedptrwgyednltwqqddfgliyrvkant
irfkayldsvyfpeaalpgnkgfrqisiitnpleakahpndpnvkaekdyydpedlmrhs
gemiymenrppiimamdqteeinilftf

SCOP Domain Coordinates for d1pdml_:

Click to download the PDB-style file with coordinates for d1pdml_.
(The format of our PDB-style files is described here.)

Timeline for d1pdml_: