| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily) |
Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family) ![]() |
| Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein) |
| Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species) |
| Species Bacteriophage T4 [TaxId:10665] [103678] (7 PDB entries) |
| Domain d1pdfq_: 1pdf Q: [94534] fitting of baseplate structural protein gp11 |
PDB Entry: 1pdf (more details), 12 Å
SCOPe Domain Sequences for d1pdfq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdfq_ i.19.1.1 (Q:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4 [TaxId: 10665]}
srladflgfrpktgdidvmnrqsvgsvtisqlakgfyepniesaindvhnfsikdvgtii
tnktgvspegvsqtdywafsgtvtddslppgspitvlvfglpvsattgmtaiefvakvrv
alqeaiasftainsykdhptdgsklevtyldnqkhvlstystygitisqeiiseskpgyg
twnllgaqtvtldnqqtptvfyhferta
Timeline for d1pdfq_: