SCOPe 2.08: Domain d1pcqn2: 1pcq N:191-366

Lineage for d1pcqn2 (1pcq N:191-366)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein GroEL, A domain [52031] (4 species)

7. Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)

8. Domain d1pcqn2: 1pcq N:191-366 [94484]
   Other proteins in same PDB: d1pcqa1, d1pcqa3, d1pcqb1, d1pcqb3, d1pcqc1, d1pcqc3, d1pcqd1, d1pcqd3, d1pcqe1, d1pcqe3, d1pcqf1, d1pcqf3, d1pcqg1, d1pcqg3, d1pcqh1, d1pcqh3, d1pcqi1, d1pcqi3, d1pcqj1, d1pcqj3, d1pcqk1, d1pcqk3, d1pcql1, d1pcql3, d1pcqm1, d1pcqm3, d1pcqn1, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_
   complexed with adp, af3, k, mg

Details for d1pcqn2

PDB Entry: 1pcq, 2.81 Å

PDB Description: Crystal structure of groEL-groES

PDB Compounds: (N:) groEL protein

SCOPe Domain Sequences for d1pcqn2:

Sequence; same for both SEQRES and ATOM records:

>d1pcqn2 c.8.5.1 (N:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

Timeline for d1pcqn2:

• d1pcqn2 first appeared in SCOP 1.67
  
• d1pcqn2 appears in SCOPe 2.07