Lineage for d1pcmx1 (1pcm X:9-154)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1622791Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 1622792Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 1622793Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 1622846Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species)
  7. 1622847Species Pseudomonas aeruginosa [TaxId:287] [69608] (12 PDB entries)
  8. 1622860Domain d1pcmx1: 1pcm X:9-154 [94440]
    Other proteins in same PDB: d1pcmx4
    complexed with m6p, zn

Details for d1pcmx1

PDB Entry: 1pcm (more details), 1.9 Å

PDB Description: enzyme-ligand complex of p. aeruginosa pmm/pgm
PDB Compounds: (X:) Phosphomannomutase

SCOPe Domain Sequences for d1pcmx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcmx1 c.84.1.1 (X:9-154) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql
iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan
eqiqalreriekndlasgvgsveqvd

SCOPe Domain Coordinates for d1pcmx1:

Click to download the PDB-style file with coordinates for d1pcmx1.
(The format of our PDB-style files is described here.)

Timeline for d1pcmx1: