Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Dihydrodipicolinate reductase [51821] (3 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [102160] (2 PDB entries) |
Domain d1p9lb1: 1p9l B:1-105,B:215-245 [94395] Other proteins in same PDB: d1p9la2, d1p9lb2 |
PDB Entry: 1p9l (more details), 2.3 Å
SCOP Domain Sequences for d1p9lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9lb1 c.2.1.3 (B:1-105,B:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis} mrvgvlgakgkvgttmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfXtsfvpgvllavrri aerpgltvgleplldlh
Timeline for d1p9lb1: