Lineage for d1p9lb1 (1p9l B:1-105,B:215-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843684Protein Dihydrodipicolinate reductase [51821] (3 species)
  7. 2843694Species Mycobacterium tuberculosis [TaxId:1773] [102160] (5 PDB entries)
  8. 2843696Domain d1p9lb1: 1p9l B:1-105,B:215-245 [94395]
    Other proteins in same PDB: d1p9la2, d1p9lb2
    complexed with nai, pdc, pg4

Details for d1p9lb1

PDB Entry: 1p9l (more details), 2.3 Å

PDB Description: Structure of M. tuberculosis dihydrodipicolinate reductase in complex with NADH and 2,6 PDC
PDB Compounds: (B:) dihydrodipicolinate reductase

SCOPe Domain Sequences for d1p9lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9lb1 c.2.1.3 (B:1-105,B:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]}
mrvgvlgakgkvgttmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfXtsfvpgvllavrri
aerpgltvgleplldlh

SCOPe Domain Coordinates for d1p9lb1:

Click to download the PDB-style file with coordinates for d1p9lb1.
(The format of our PDB-style files is described here.)

Timeline for d1p9lb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p9lb2