Lineage for d1p9du_ (1p9d U:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402612Protein Ubiquitin-like domain of Rad23 homolog A (Hhr23a) [102775] (1 species)
  7. 1402613Species Human (Homo sapiens) [TaxId:9606] [102776] (4 PDB entries)
  8. 1402616Domain d1p9du_: 1p9d U: [94388]
    Other proteins in same PDB: d1p9ds_
    complexed with the C-terminal ubiquitin-interacting motif of the proteasome subunit s5a

Details for d1p9du_

PDB Entry: 1p9d (more details)

PDB Description: high-resolution structure of the complex of hhr23a ubiquitin-like domain and the c-terminal ubiquitin-interacting motif of proteasome subunit s5a
PDB Compounds: (U:) uv excision repair protein rad23 homolog a

SCOPe Domain Sequences for d1p9du_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9du_ d.15.1.1 (U:) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]}
mavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
irdyrideknfvvvmvtk

SCOPe Domain Coordinates for d1p9du_:

Click to download the PDB-style file with coordinates for d1p9du_.
(The format of our PDB-style files is described here.)

Timeline for d1p9du_: