SCOPe 2.08: Domain d1p9du_: 1p9d U:

Lineage for d1p9du_ (1p9d U:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Ubiquitin-like domain of Rad23 homolog A (Hhr23a) [102775] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102776] (4 PDB entries)

8. Domain d1p9du_: 1p9d U: [94388]
   Other proteins in same PDB: d1p9ds_
   complexed with the C-terminal ubiquitin-interacting motif of the proteasome subunit s5a

Details for d1p9du_

PDB Entry: 1p9d

PDB Description: high-resolution structure of the complex of hhr23a ubiquitin-like domain and the c-terminal ubiquitin-interacting motif of proteasome subunit s5a

PDB Compounds: (U:) uv excision repair protein rad23 homolog a

SCOPe Domain Sequences for d1p9du_:

Sequence; same for both SEQRES and ATOM records:

>d1p9du_ d.15.1.1 (U:) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]}
mavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
irdyrideknfvvvmvtk

Timeline for d1p9du_:

• d1p9du_ first appeared in SCOP 1.67
  
• d1p9du_ appears in SCOPe 2.07