Lineage for d1p8xb3 (1p8x B:629-741)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417014Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 417015Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 417016Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 417017Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 417031Species Human (Homo sapiens) [TaxId:9606] [55761] (17 PDB entries)
  8. 417043Domain d1p8xb3: 1p8x B:629-741 [94370]

Details for d1p8xb3

PDB Entry: 1p8x (more details), 2 Å

PDB Description: The Calcium-Activated C-terminal half of gelsolin

SCOP Domain Sequences for d1p8xb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8xb3 d.109.1.1 (B:629-741) Gelsolin {Human (Homo sapiens)}
rlkdkkmdahpprlfacsnkigrfvieevpgelmqedlatddvmlldtwdqvfvwvgkds
qeeektealtsakryietdpanrdrrtpitvvkqgfeppsfvgwflgwdddyw

SCOP Domain Coordinates for d1p8xb3:

Click to download the PDB-style file with coordinates for d1p8xb3.
(The format of our PDB-style files is described here.)

Timeline for d1p8xb3: